Home - Products - Others - Other Targets - Parathyroid Hormone (1-34), human

Parathyroid Hormone (1-34), human

CAS No. ———

Parathyroid Hormone (1-34), human( ——— )

Catalog No. M41497 CAS No. ———

Parathyroid Hormone (1-34), human

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    Parathyroid Hormone (1-34), human
  • Note
    Research use only, not for human use.
  • Brief Description
    Parathyroid Hormone (1-34), human
  • Description
    Parathyroid Hormone (1-34), human
  • In Vitro
    ———
  • In Vivo
    ———
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ———
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    ———
  • Formula Weight
    4117.8
  • Molecular Formula
    C181H291N55O51S2
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • OSBPL7-IN-1

    OSBPL7-IN-1 is an orally active inhibitor of oxysterol binding protein like 7 (OSBPL7). OSBPL7-IN-1 promotes an increase of ABCA1 at the plasma membrane without affecting mRNA expression.

  • L524-0366

    L524-0366 is a TWEAK-Fn14 signaling cascade inhibitor.L524-0366 mitigated maladaptive remodeling with TAC. TWEAK induced secretion of the pro-inflammatory chemokine, monocyte chemoattractant protein 1 from WT but not Fn14-/-?fibroblasts in vitro, in part through activation of non-canonical NF-κB signaling.