Exendin-4 peptide derivative

CAS No. ——

Exendin-4 peptide derivative( FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS )

Catalog No. M29860 CAS No. ——

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote

Biological Information

  • Product Name
    Exendin-4 peptide derivative
  • Note
    Research use only, not for human use.
  • Brief Description
    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.
  • Description
    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. (In Vitro):Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    ——
  • Formula Weight
    3692.15
  • Molecular Formula
    ——
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    Sequence:Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

US20150315260 A1
molnova catalog
related products
  • Skimmianin

    Skimmianin is a spasmolytic agent. Skimmianin shows pharmacol. props. similar to 2-(Methylamino)-1-phenyl-1-propanol BCJ45-G.

  • MARK Substrate

    MARK Substrate is a MARK substrate peptide.

  • 4-Hydroxy-5-methyl-3...

    4-Hydroxy-5-methyl-3-furanone is a natural product isolated from Eurycotis floridana.