Sophoraflavone A

CAS No. 105594-08-9

Sophoraflavone A( —— )

Catalog No. M32483 CAS No. 105594-08-9

The roots of Sophora flavescens.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
10MG 551 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Sophoraflavone A
  • Note
    Research use only, not for human use.
  • Brief Description
    The roots of Sophora flavescens.
  • Description
    The roots of Sophora flavescens.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    105594-08-9
  • Formula Weight
    562.5
  • Molecular Formula
    C27H30O13
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO, Pyridine, Methanol, Ethanol, etc.
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Fructo-oligosacchari...

    Fructo-oligosaccharide DP14 is an oligosaccharide that can be isolated from Atractylodes lancea.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • LIT-001

    LIT-001 improves social interaction in a mouse model of autism.It is the first nonpeptide oxytocin receptor agonist with EC50 of 55 nM and Ki of 226 nM.