Home - Products - Others - Other Targets - (D-Val22)-Big Endothelin-1 fragment (16-38) (human)

(D-Val22)-Big Endothelin-1 fragment (16-38) (human)

CAS No. 158884-64-1

(D-Val22)-Big Endothelin-1 fragment (16-38) (human)( ——— )

Catalog No. M40163 CAS No. 158884-64-1

(D-Val22)-Big Endothelin-1 fragment (16-38) (human)

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    (D-Val22)-Big Endothelin-1 fragment (16-38) (human)
  • Note
    Research use only, not for human use.
  • Brief Description
    (D-Val22)-Big Endothelin-1 fragment (16-38) (human)
  • Description
    (D-Val22)-Big Endothelin-1 fragment (16-38) (human)
  • In Vitro
    ———
  • In Vivo
    ———
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ———
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    158884-64-1
  • Formula Weight
    2586.96
  • Molecular Formula
    C119H180N32O33
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • NSP-SA-NHS

    NSP-SA-NHS is a chemiluminescent acridinium ester that can be used for immunoassays.

  • Astragaloside(b)

    Astragaloside may protect against brain contusion and neuronal apoptosis after TBI by attenuating microglia activation in male rats. Astragalosides-induced apoptosis in NB4 cells may be associated with down-regulation of the expression of BCL-2 and NF-κB finally the relative activity of caspase-3 activated.