Astin C

CAS No. 148057-23-2

Astin C( —— )

Catalog No. M31942 CAS No. 148057-23-2

Astin C has antitumor activity.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
10MG 459 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Astin C
  • Note
    Research use only, not for human use.
  • Brief Description
    Astin C has antitumor activity.
  • Description
    Astin C has antitumor activity.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    148057-23-2
  • Formula Weight
    570.5
  • Molecular Formula
    C25H33N5O6Cl2
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Pomolic acid 28-O-be...

    Pomolic acid 28-O-beta-D-glucopyranosyl ester is a natural product.

  • Itolizumab

    Itolizumab (Anti-Human CD6 Recombinant Antibody) is a recombinant anti-CD6 monoclonal antibody that targets the extracellular SRCR distal domain 1 of CD6, thereby slowing T cell proliferation and inhibiting pro-inflammatory cytokine production.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.