Kansuinine E

CAS No. 672945-84-5

Kansuinine E( —— )

Catalog No. M31347 CAS No. 672945-84-5

Kansuinine E, a jatrophane-type diterpenoid, is a plant-derived compound isolated from the roots of E. kansui. It functions as a nitric oxide inhibitor, with an inhibitory concentration of 6.3 μM (IC50).

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 873 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock

Biological Information

  • Product Name
    Kansuinine E
  • Note
    Research use only, not for human use.
  • Brief Description
    Kansuinine E, a jatrophane-type diterpenoid, is a plant-derived compound isolated from the roots of E. kansui. It functions as a nitric oxide inhibitor, with an inhibitory concentration of 6.3 μM (IC50).
  • Description
    Kansuinine E, a jatrophane-type diterpenoid, is a plant-derived compound isolated from the roots of E. kansui. It functions as a nitric oxide inhibitor, with an inhibitory concentration of 6.3 μM (IC50).
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    672945-84-5
  • Formula Weight
    777.8
  • Molecular Formula
    C41H47NO14
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Rosarin

    Rosarin has anti-inflammatory and neuroprotective effects.?Rosarin supresses the expression of the proinflammatory factors iNOS, IL-1 β, and TNF- α in the kidney and prefrontal cortex of brain in mice .

  • Myricoside

    Myricoside is a natural product isolated from the aerial parts of Phlomis oppositiflora.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.