Sodium carbonate

CAS No. 497-19-8

Sodium carbonate( Disodium carbonate | Soda Ash | Carbonic acid disodium salt )

Catalog No. M27578 CAS No. 497-19-8

Sodium Carbonate, also named as Disodium carbonate, Soda Ash, Carbonic acid disodium salt, is the disodium salt of carbonic acid with alkalinizing property.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG 45 In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Sodium carbonate
  • Note
    Research use only, not for human use.
  • Brief Description
    Sodium Carbonate, also named as Disodium carbonate, Soda Ash, Carbonic acid disodium salt, is the disodium salt of carbonic acid with alkalinizing property.
  • Description
    Sodium Carbonate, also named as Disodium carbonate, Soda Ash, Carbonic acid disodium salt, is the disodium salt of carbonic acid with alkalinizing property.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    Disodium carbonate | Soda Ash | Carbonic acid disodium salt
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    PDE4
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    497-19-8
  • Formula Weight
    105.988
  • Molecular Formula
    CNa2O3
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    [Na]OC(=O)O[Na]
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Chorostowska-Wynimko J, Kus J, Skopińska-Rózewska E. Theophylline inhibits free oxygen radicals production by human monocytes via phosphodiesterase inhibition. J Physiol Pharmacol. 2007;58 Suppl 5(Pt 1):95-103.
molnova catalog
related products
  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • 4-O-Methylhonokiol

    4-O-Methyl honokiol, a natural neolignan isolated from Magnolia officinalis, acts as a PPARγ agonist and inhibits NF-κB activity, used for cancer and inflammation research.

  • 4-Cyclohexylphenol

    4-Cyclohexylphenol is a biochemical compound for proteomics research.