Cart
sales@molnova.com
Home - Products - Others - Other Targets - Oxyfluorfen

Oxyfluorfen

CAS No. 42874-03-3

Oxyfluorfen( Boxer | Galigan | Goldate | Koltar | RH-2915 | RH 2915 )

Catalog No. M27307 CAS No. 42874-03-3

Oxyfluorfen, a herbicide of the nitrodiphenyl ether class, is used to control annual and perennial broad-leaved weeds and sedges in a variety of field crops.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 44 In Stock
25MG 29 In Stock
50MG 38 In Stock
100MG 53 In Stock
200MG Get Quote In Stock
500MG 161 In Stock
1G Get Quote In Stock
Get Quotation Bulk Inquiry Add to Cart

Biological Information

  • Product Name
    Oxyfluorfen
  • Note
    Research use only, not for human use.
  • Brief Description
    Oxyfluorfen, a herbicide of the nitrodiphenyl ether class, is used to control annual and perennial broad-leaved weeds and sedges in a variety of field crops.
  • Description
    Oxyfluorfen, a herbicide of the nitrodiphenyl ether class, is used to control annual and perennial broad-leaved weeds and sedges in a variety of field crops.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    Boxer | Galigan | Goldate | Koltar | RH-2915 | RH 2915
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ALK5
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    42874-03-3
  • Formula Weight
    361.7
  • Molecular Formula
    C15H11ClF3NO4
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    CCOc1cc(Oc2ccc(cc2Cl)C(F)(F)F)ccc1[N+]([O-])=O
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Jin CH, Krishnaiah M, Sreenu D, Subrahmanyam VB, Rao KS, Lee HJ, Park SJ, Park HJ, Lee K, Sheen YY, Kim DK. Discovery of N-((4-([1,2,4]triazolo[1,5-a]pyridin-6-yl)-5-(6-methylpyridin-2-yl)-1H-imidazol-2-yl)methyl)-2-fluoroaniline (EW-7197): a highly potent, selective, and orally bioavailable inhibitor of TGF-β type I receptor kinase as cancer immunotherapeutic/antifibrotic agent. J Med Chem. 2014 May 22;57(10):4213-38. doi: 10.1021/jm500115w. Epub 2014 May 13. PMID: 24786585.
Calculator

Molecular Weight Calculator

Dilution Calculator

Molarity Calculator

molnova catalog
related products

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Secretin Acetate, po...

    Secretin (swine), a neuroendocrine hormone, is the first hormone to be identifie and is secreted by S cells that are localized primarily in the mucosa of the duodenum. Secretin also is a 27-amino acid peptide, which acts on secretin receptors. Secretin is expressed by cells in all mature enteroendocrine cell subsets and can be prompted by fatty acids. Secretin stimulates the secretion of pancreatic water and bicarbonate. Secretin exerts various effects in organs, can be used for the research of digestive system, central nervous system and energy metabolism.

  • UCM-1336

    UCM-1336 is a potent ICMT inhibitor with an IC50 of 2 μM which is selective against the other enzymes involved in the post-translational modifications of Ras.

Sign In Join Free