(S,R,S)-AHPC-PEG4-N3

CAS No. 1797406-81-5

(S,R,S)-AHPC-PEG4-N3( VH032-PEG4-N3 | VHL Ligand-Linker Conjugates 5 | E3 ligase Ligand-Linker Conjugates 4 )

Catalog No. M26950 CAS No. 1797406-81-5

(S,R,S)-AHPC-PEG4-N3 is a synthesized E3 ligase ligand-linker conjugate that incorporates the (S,R,S)-AHPC based VHL ligand and 4-unit PEG linker used in PROTAC technology.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
2MG 38 In Stock
5MG 61 In Stock
10MG 88 In Stock
25MG 148 In Stock
50MG 237 In Stock
100MG 423 In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    (S,R,S)-AHPC-PEG4-N3
  • Note
    Research use only, not for human use.
  • Brief Description
    (S,R,S)-AHPC-PEG4-N3 is a synthesized E3 ligase ligand-linker conjugate that incorporates the (S,R,S)-AHPC based VHL ligand and 4-unit PEG linker used in PROTAC technology.
  • Description
    (S,R,S)-AHPC-PEG4-N3 is a synthesized E3 ligase ligand-linker conjugate that incorporates the (S,R,S)-AHPC based VHL ligand and 4-unit PEG linker used in PROTAC technology.(In Vitro):E3 ligase Ligand-Linker Conjugates 4 together with JQ1 triggers the intracellular destruction of BET proteins.
  • In Vitro
    E3?ligase Ligand-Linker Conjugates 4 together with JQ1 triggers the intracellular destruction of BET proteins.
  • In Vivo
    ——
  • Synonyms
    VH032-PEG4-N3 | VHL Ligand-Linker Conjugates 5 | E3 ligase Ligand-Linker Conjugates 4
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ATP-sensitive potassium (KATP) channels
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    1797406-81-5
  • Formula Weight
    689.82
  • Molecular Formula
    C32H47N7O8S
  • Purity
    >98% (HPLC)
  • Solubility
    In Vitro:?H2O : 100 mg/mL (144.97 mM)
  • SMILES
    O=C(N[C@@H](C(C)(C)C)C(N(C[C@H](O)C1)[C@@H]1C(NCC2=CC=C(C(SC=N3)=C3C)C=C2)=O)=O)COCCOCCOCCOCCN=[N+]=[N-]
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.L?ffler C, et al. Pharmacological characterization of the sulphonylurea receptor in rat isolated aorta. Br J Pharmacol. 1997 Feb;120(3):476-80.
molnova catalog
related products
  • N-[2-nitro-4-(triflu...

    N-[2-nitro-4-(trifluoromethyl)phenyl]piperazine is a biologically active compound belonging to the piperazine group.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • Protostemotinine

    Protostemotinine is a natural product from Stemona japonica.