Dexamethasone 9,11-epoxide

CAS No. 24916-90-3

Dexamethasone 9,11-epoxide( —— )

Catalog No. M24136 CAS No. 24916-90-3

Dexamethasone 9,11-epoxide is a compound obtained by extraction and is an intermediate in the preparation of dexamethasone.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 29 In Stock
50MG 33 In Stock
100MG 52 In Stock
200MG Get Quote In Stock
500MG 132 In Stock
1G 184 In Stock

Biological Information

  • Product Name
    Dexamethasone 9,11-epoxide
  • Note
    Research use only, not for human use.
  • Brief Description
    Dexamethasone 9,11-epoxide is a compound obtained by extraction and is an intermediate in the preparation of dexamethasone.
  • Description
    Dexamethasone 9,11-epoxide is a compound obtained by extraction and is an intermediate in the preparation of dexamethasone.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    24916-90-3
  • Formula Weight
    372.45
  • Molecular Formula
    C22H28O5
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO:95mg/mL 255.07 mM;Need ultrasonic);H2O: < 0.1 mg/mL (insoluble)
  • SMILES
    C[C@@]12[C@](C(CO)=O)(O)[C@H](C)C[C@@]1([H])[C@]3([H])CCC4=CC(C=C[C@]4(C)[C@]3(O5)[C@]5([H])C2)=O
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • 1H-Indole-3-ethanami...

    1H-Indole-3-ethanamine, 5-bromo-N,N-dimethyl-, hydrochloride is a marine derived natural products found in Smenospongia echina.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • Limocitrin 3-O-sopho...

    Limocitrin 3-O-sophoroside is a compound that can be used in biological research.