Hydrocinnamic alcohol

CAS No. 122-97-4

Hydrocinnamic alcohol( —— )

Catalog No. M19330 CAS No. 122-97-4

Hydrocinnamic alcohol exists in storax and fern balsam, also present in Vaccinium species fruits, guava fruit and peel, blackberry, other fruits, rum, white wine, shitake mushroom, matsutake mushroom and peated malt. It is a flavoring ingredient.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 49 In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Hydrocinnamic alcohol
  • Note
    Research use only, not for human use.
  • Brief Description
    Hydrocinnamic alcohol exists in storax and fern balsam, also present in Vaccinium species fruits, guava fruit and peel, blackberry, other fruits, rum, white wine, shitake mushroom, matsutake mushroom and peated malt. It is a flavoring ingredient.
  • Description
    Hydrocinnamic alcohol exists in storax and fern balsam, also present in Vaccinium species fruits, guava fruit and peel, blackberry, other fruits, rum, white wine, shitake mushroom, matsutake mushroom and peated malt. It is a flavoring ingredient.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    122-97-4
  • Formula Weight
    136.19
  • Molecular Formula
    C9H12O
  • Purity
    >98% (HPLC)
  • Solubility
    In Vitro:?DMSO : 100 mg/mL (734.27 mM)
  • SMILES
    C1=CC=C(C=C1)CCCO
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Sodium 3-nitrobenzen...

    Sodium 3-nitrobenzenesulfonate is a mild oxidant. Sodium 3-nitrobenzenesulfonate can protect the shade when fabrics are printed or steamed in pad dyeing and counteract the effect of reducing substances.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • Gomisin M2

    Gomisin M2 ((+)-Gomisin M2) is a lignan isolated from the fruits of Schisandra rubriflora with anti-HIV activity (EC50 of 2.4 μM). Gomisin M2 exhibits anti-cancer and anti-allergic activities and has the potential for Alzheimer’s disease research.