Isomartynoside

CAS No. 94410-22-7

Isomartynoside( —— )

Catalog No. M31094 CAS No. 94410-22-7

Isomartynoside has inhibition against the angiotensin converting enzyme (ACE) activities, the IC 50 value is 505±26.7μg/ml, it may have antihypertensive effect. Isomartynoside also shows obvious anti-fatigue activity.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 495 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock

Biological Information

  • Product Name
    Isomartynoside
  • Note
    Research use only, not for human use.
  • Brief Description
    Isomartynoside has inhibition against the angiotensin converting enzyme (ACE) activities, the IC 50 value is 505±26.7μg/ml, it may have antihypertensive effect. Isomartynoside also shows obvious anti-fatigue activity.
  • Description
    Isomartynoside has inhibition against the angiotensin converting enzyme (ACE) activities, the IC 50 value is 505±26.7μg/ml, it may have antihypertensive effect. Isomartynoside also shows obvious anti-fatigue activity.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    94410-22-7
  • Formula Weight
    652.7
  • Molecular Formula
    C31H40O15
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Azaserine

    Azaserine is a tumor-inhibiting antibiotic isolated from a species of Streptomyces and functions as an inhibitor of glutamine amidotransferase.

  • 6,7-Dihydroxyflavone

    6,7-Dihydroxyflavone is a natural product for research related to life sciences.