Home - Products - Others - Other Targets - TET 830 modified/T - helper epitope from tetanus toxoid

TET 830 modified/T - helper epitope from tetanus toxoid

CAS No. ———

TET 830 modified/T - helper epitope from tetanus toxoid( ——— )

Catalog No. M41981 CAS No. ———

TET 830 modified/T - helper epitope from tetanus toxoid

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote

Biological Information

  • Product Name
    TET 830 modified/T - helper epitope from tetanus toxoid
  • Note
    Research use only, not for human use.
  • Brief Description
    TET 830 modified/T - helper epitope from tetanus toxoid
  • Description
    TET 830 modified/T - helper epitope from tetanus toxoid
  • In Vitro
    ———
  • In Vivo
    ———
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ———
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    ———
  • Formula Weight
    1796.11
  • Molecular Formula
    C83H134N20O24
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • 6-Hydroxyrubiadin

    6-Hydroxyrubiadin has antioxidant activity, EC(50) is 14.7ug/ml.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Compound TCFN92660

    Hispidin is a natural product, protein kinase C inhibitor, which belongs to the group of 2-pyrones and catechols.