Home - Products - Others - Other Targets - Biotin-VIP (human, bovine, porcine, rat)

Biotin-VIP (human, bovine, porcine, rat)

CAS No. ———

Biotin-VIP (human, bovine, porcine, rat)( ——— )

Catalog No. M41763 CAS No. ———

Biotin-VIP (human, bovine, porcine, rat)

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    Biotin-VIP (human, bovine, porcine, rat)
  • Note
    Research use only, not for human use.
  • Brief Description
    Biotin-VIP (human, bovine, porcine, rat)
  • Description
    Biotin-VIP (human, bovine, porcine, rat)
  • In Vitro
    ———
  • In Vivo
    ———
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ———
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    ———
  • Formula Weight
    3552.17
  • Molecular Formula
    C157H252N46O44S2
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • AC 45594

    AC 45594 is an agonist of steroidogenic factor 1 (SF-1) ( IC50 : 50-100 nM).

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • ELOVL6-IN-1

    ELOVL6-IN-1 is a potent, orally active and selective?ELOVL6?inhibitor. ELOVL6-IN-1 dose-dependently inhibits mouse?ELOVL6?activities.