Home - Products - Others - Other Targets - (D-Arg6)-Dynorphin A (1-13)|[D-Arg6]-Dynorphin A (1-13),porcine

(D-Arg6)-Dynorphin A (1-13)|[D-Arg6]-Dynorphin A (1-13),porcine

CAS No. 75921-87-8

(D-Arg6)-Dynorphin A (1-13)|[D-Arg6]-Dynorphin A (1-13),porcine( ——— )

Catalog No. M40144 CAS No. 75921-87-8

(D-Arg6)-Dynorphin A (1-13)|[D-Arg6]-Dynorphin A (1-13),porcine

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    (D-Arg6)-Dynorphin A (1-13)|[D-Arg6]-Dynorphin A (1-13),porcine
  • Note
    Research use only, not for human use.
  • Brief Description
    (D-Arg6)-Dynorphin A (1-13)|[D-Arg6]-Dynorphin A (1-13),porcine
  • Description
    (D-Arg6)-Dynorphin A (1-13)|[D-Arg6]-Dynorphin A (1-13),porcine
  • In Vitro
    ———
  • In Vivo
    ———
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ———
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    75921-87-8
  • Formula Weight
    1603.98
  • Molecular Formula
    C75H126N24O15
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Rhodopsin Epitope Ta...

    Rhodopsin Epitope Tag is a 9-amino acid peptide representing C terminus of bovine rhodopsin widely used as an epitope tag. A number of anti-rhodopsin antibodies can recognize this epitope.

  • Prosaptide, wild typ...

    Prosaptide, wild type