Hinesol
CAS No. 23811-08-7
Hinesol( ——— )
Catalog No. M38718 CAS No. 23811-08-7
(-)-Hinesol (Hinesol) is a potent anticancer agent. (-)-Hinesol induces apoptosis and cell cycle arrest at G0/G1 phase. (-)-Hinesol downregulates MEK/ERK pathway and NF-κB pathway and mediates theexpression of cyclin D1, Bax and Bcl-2. (-)-Hinesol has the potential for the research of non–small cell lung cancer.
Purity : >98% (HPLC)
COA
Datasheet
HNMR
HPLC
MSDS
Handing Instructions
| Size | Price / USD | Stock | Quantity |
| 25MG | Get Quote | Get Quote |
|
| 50MG | Get Quote | Get Quote |
|
| 100MG | Get Quote | Get Quote |
|
| 200MG | Get Quote | Get Quote |
|
| 500MG | Get Quote | Get Quote |
|
| 1G | Get Quote | Get Quote |
|
Biological Information
-
Product NameHinesol
-
NoteResearch use only, not for human use.
-
Brief Description(-)-Hinesol (Hinesol) is a potent anticancer agent. (-)-Hinesol induces apoptosis and cell cycle arrest at G0/G1 phase. (-)-Hinesol downregulates MEK/ERK pathway and NF-κB pathway and mediates theexpression of cyclin D1, Bax and Bcl-2. (-)-Hinesol has the potential for the research of non–small cell lung cancer.
-
DescriptionHinesol is a unique sesquiterpenoid isolated from Atractylodes lancea rhizome. Hinesol has been found to induce apoptosis through the JNK signaling pathway in HL-60 cells.
-
In Vitro(-)-Hinesol (0-25 μg/ml; 24, 48 h) shows antiproliferative activity of the A549 and NCI-H1299 cells in a dose- and time-dependent manner.(-)-Hinesol (0, 2, 8 μg/ml; 24 h) induces apoptosis and cell cycle arrest at G0/G1 phase with increases the expression of Bax and decreases the expression of Bcl-2 and cyclin D1.(-)-Hinesol (0, 2, 8 μg/ml; 24 h) decreases the expression of phosphor-ERK1/2, phosphor-MEK1/2, phosphor-IκBα and -p65 level, and shows no change forthe total protein levels of IκBα and p65 in A549 cells.Cell Proliferation Assay Cell Line:A549, NCI-H1299 cells Concentration:0-25 μg/ml Incubation Time:24, 48 h Result:Inhibited the proliferation of the A549 and NCI-H1299 cells in a dose- and time-dependent manner.Apoptosis Analysis Cell Line:A549 cells Concentration:0, 2, 8 μg/ml Incubation Time:24 h Result:Induced apoptosis with the apoptotic cells was increased to 21.2?±?0.96% and 36?±?1.04% after treatment with hinesol at 2 and 8?μg/mL, respectively.Western Blot Analysis Cell Line:A549 cells Concentration:0, 2, 8 μg/ml Incubation Time:24 h Result:Increased the protein expression of Bax and decreased the expression of Bcl-2.Cell Cycle Analysis Cell Line:A549 cells Concentration:0, 2, 8 μg/ml Incubation Time:24 h Result:Showed concentration-dependent increase in the percentage of cell in the G0/G1 phase, and a decrease of the percentage in G2/M phase.
-
In Vivo———
-
Synonyms———
-
PathwayOthers
-
TargetOther Targets
-
Recptor———
-
Research Area———
-
Indication———
Chemical Information
-
CAS Number23811-08-7
-
Formula Weight222.37
-
Molecular FormulaC15H26O
-
Purity>98% (HPLC)
-
Solubility———
-
SMILES———
-
Chemical Name——
Shipping & Storage Information
-
Storage(-20℃)
-
ShippingWith Ice Pack
-
Stability≥ 2 years
Reference
1. Guo W, et al. The antitumor effect of hinesol, extract from Atractylodes lancea (Thunb.) DC. by proliferation, inhibition, and apoptosis induction via MEK/ERK and NF-κB pathway in non-small cell lung cancer cell lines A549 and NCI-H1299. J Cell Biochem. 2019 Nov;120(11):18600-18607. ?
molnova catalog
related products
-
YD23
YD23 is a PROTAC that induces SMARCA2 degradation, has anticancer activity, and selectively inhibits the growth of SMARCA4 mutant lung cancer cells in vitro.
-
Pelretin
Pelretin is a synthetic retinoid.
-
Exendin-4 peptide de...
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
Cart
sales@molnova.com