Hinesol

CAS No. 23811-08-7

Hinesol( ——— )

Catalog No. M38718 CAS No. 23811-08-7

(-)-Hinesol (Hinesol) is a potent anticancer agent. (-)-Hinesol induces apoptosis and cell cycle arrest at G0/G1 phase. (-)-Hinesol downregulates MEK/ERK pathway and NF-κB pathway and mediates theexpression of cyclin D1, Bax and Bcl-2. (-)-Hinesol has the potential for the research of non–small cell lung cancer.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG Get Quote Get Quote
50MG Get Quote Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    Hinesol
  • Note
    Research use only, not for human use.
  • Brief Description
    (-)-Hinesol (Hinesol) is a potent anticancer agent. (-)-Hinesol induces apoptosis and cell cycle arrest at G0/G1 phase. (-)-Hinesol downregulates MEK/ERK pathway and NF-κB pathway and mediates theexpression of cyclin D1, Bax and Bcl-2. (-)-Hinesol has the potential for the research of non–small cell lung cancer.
  • Description
    Hinesol is a unique sesquiterpenoid isolated from Atractylodes lancea rhizome. Hinesol has been found to induce apoptosis through the JNK signaling pathway in HL-60 cells.
  • In Vitro
    (-)-Hinesol (0-25 μg/ml; 24, 48 h) shows antiproliferative activity of the A549 and NCI-H1299 cells in a dose- and time-dependent manner.(-)-Hinesol (0, 2, 8 μg/ml; 24 h) induces apoptosis and cell cycle arrest at G0/G1 phase with increases the expression of Bax and decreases the expression of Bcl-2 and cyclin D1.(-)-Hinesol (0, 2, 8 μg/ml; 24 h) decreases the expression of phosphor-ERK1/2, phosphor-MEK1/2, phosphor-IκBα and -p65 level, and shows no change forthe total protein levels of IκBα and p65 in A549 cells.Cell Proliferation Assay Cell Line:A549, NCI-H1299 cells Concentration:0-25 μg/ml Incubation Time:24, 48 h Result:Inhibited the proliferation of the A549 and NCI-H1299 cells in a dose- and time-dependent manner.Apoptosis Analysis Cell Line:A549 cells Concentration:0, 2, 8 μg/ml Incubation Time:24 h Result:Induced apoptosis with the apoptotic cells was increased to 21.2?±?0.96% and 36?±?1.04% after treatment with hinesol at 2 and 8?μg/mL, respectively.Western Blot Analysis Cell Line:A549 cells Concentration:0, 2, 8 μg/ml Incubation Time:24 h Result:Increased the protein expression of Bax and decreased the expression of Bcl-2.Cell Cycle Analysis Cell Line:A549 cells Concentration:0, 2, 8 μg/ml Incubation Time:24 h Result:Showed concentration-dependent increase in the percentage of cell in the G0/G1 phase, and a decrease of the percentage in G2/M phase.
  • In Vivo
    ———
  • Synonyms
    ———
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ———
  • Research Area
    ———
  • Indication
    ———

Chemical Information

  • CAS Number
    23811-08-7
  • Formula Weight
    222.37
  • Molecular Formula
    C15H26O
  • Purity
    >98% (HPLC)
  • Solubility
    ———
  • SMILES
    ———
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. Guo W, et al. The antitumor effect of hinesol, extract from Atractylodes lancea (Thunb.) DC. by proliferation, inhibition, and apoptosis induction via MEK/ERK and NF-κB pathway in non-small cell lung cancer cell lines A549 and NCI-H1299. J Cell Biochem. 2019 Nov;120(11):18600-18607. ?
molnova catalog
related products
  • YD23

    YD23 is a PROTAC that induces SMARCA2 degradation, has anticancer activity, and selectively inhibits the growth of SMARCA4 mutant lung cancer cells in vitro.

  • Pelretin

    Pelretin is a synthetic retinoid.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.