Dalvastatin

CAS No. 132100-55-1

Dalvastatin( —— )

Catalog No. M34066 CAS No. 132100-55-1

Dalvastatin (RG-12561) is an orally available inhibitor of HMG-CoA reductase and cholesterol-lowering synthesis.Dalvastatin competitively inhibits rat hepatic HMG-CoA reductase with an IC50 value of 3.4 nmol / l.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
2MG 290 Get Quote
5MG 456 Get Quote
10MG 653 Get Quote
25MG 994 Get Quote
50MG 1362 Get Quote
100MG 1791 Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    Dalvastatin
  • Note
    Research use only, not for human use.
  • Brief Description
    Dalvastatin (RG-12561) is an orally available inhibitor of HMG-CoA reductase and cholesterol-lowering synthesis.Dalvastatin competitively inhibits rat hepatic HMG-CoA reductase with an IC50 value of 3.4 nmol / l.
  • Description
    Dalvastatin (RG-12561) inhibitor of HMG-CoA reductase and cholesterol-lowering synthesis.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    HMG-CoA Reductase
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    132100-55-1
  • Formula Weight
    386.5
  • Molecular Formula
    C24H31FO3
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    C(=C/[C@H]1C[C@H](O)CC(=O)O1)\C2=C(CC(C)(C)CC2(C)C)C3=CC(C)=C(F)C=C3
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. C M Won, et al. Epimerization and hydrolysis of dalvastatin, a new hydroxymethylglutaryl coenzyme A (HMG-CoA) reductase inhibitor. Pharm Res. 1994 Jan;11(1):165-70.?
molnova catalog
related products
  • Dauricumine

    Dauricumine is a chlorinated alkaloid that inhibits NF-κB ligand-induced differentiation of mouse bone marrow-derived macrophages into multinucleated osteoclasts.

  • 6-OH-BTA-0

    6-OH-BTA-0 (11C-PiB Precursor) is an intermediate for synthetic pesticides and a precursor of 6-OH-BTA-1, which can be used to synthesize β-amyloid imaging agents.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.