Home - Products - Others - Other Targets - 4-Hydroxy-3,5,5,6,7,8-hexamethoxyflavone

4-Hydroxy-3,5,5,6,7,8-hexamethoxyflavone

CAS No. 85644-03-7

4-Hydroxy-3,5,5,6,7,8-hexamethoxyflavone( —— )

Catalog No. M32352 CAS No. 85644-03-7

The herbs of Eupatorium coelestinum.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 551 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    4-Hydroxy-3,5,5,6,7,8-hexamethoxyflavone
  • Note
    Research use only, not for human use.
  • Brief Description
    The herbs of Eupatorium coelestinum.
  • Description
    The herbs of Eupatorium coelestinum.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    85644-03-7
  • Formula Weight
    418.4
  • Molecular Formula
    C21H22O9
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO, Pyridine, Methanol, Ethanol, etc.
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Phytic acid dipotass...

    Phytic acid exists in all eukaryotic cells. In plants it is known to function as a [PO4]3? storage depot and precursor for other inositol phosphates and pyrophosphates. It can be used clinically as a complexing agent for removal of traces of heavy metal ions. It acts also as a hypocalcemic agent.

  • Hydroxygenkwanin

    Hydroxygenkwanin has cytotoxicity, may be an effective natural product to treat glioma, and the combination of Apigenin and Hydroxygenkwanin may be a promising method for glioma chemotherapy.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.