Perlolyrine

CAS No. 29700-20-7

Perlolyrine( —— )

Catalog No. M32199 CAS No. 29700-20-7

Perlolyrine is a natural product for research related to life sciences.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 111 In Stock
10MG 178 In Stock
25MG 357 In Stock
50MG 550 In Stock
100MG 901 In Stock
200MG 1190 In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Perlolyrine
  • Note
    Research use only, not for human use.
  • Brief Description
    Perlolyrine is a natural product for research related to life sciences.
  • Description
    Perlolyrine is a natural product for research related to life sciences.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    29700-20-7
  • Formula Weight
    264.3
  • Molecular Formula
    C16H12N2O2
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • α-Defensin 6

    α-Defensin 6

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • 5-Bromouracil

    5-Bromouracil disrupts nucleosome positioning by inducing A-form-like DNA.