Cart
sales@molnova.com
Home - Products - Others - Other Targets - 5-Methoxypiperonal

5-Methoxypiperonal

CAS No. 5780-07-4

5-Methoxypiperonal( —— )

Catalog No. M32042 CAS No. 5780-07-4

Reference standards.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
50MG Get Quote In Stock
100MG Get Quote In Stock
Get Quotation Bulk Inquiry Add to Cart

Biological Information

  • Product Name
    5-Methoxypiperonal
  • Note
    Research use only, not for human use.
  • Brief Description
    Reference standards.
  • Description
    Reference standards.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    5780-07-4
  • Formula Weight
    180.1
  • Molecular Formula
    C9H8O4
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO, Pyridine, Methanol, Ethanol, etc.
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

Calculator

Molecular Weight Calculator

Dilution Calculator

Molarity Calculator

molnova catalog
related products

  • Senkyunolide

    Senkyunolide A is a natural product isolated from Ligusticum chuanxiong Hort, with anti-tumor activity.To determine the equilibrium solubility of senkyunoide and its partition coefficients for the n-octanol-water/buffer solution systems,so as to provide a basis for new formulations designing.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Indigo carmine

    Indigo carmine is an indolesulfonic acid. It is used as a dye in renal function testing for the detection of nitrates and chlorates.

Sign In Join Free