Isoangustone A
CAS No. 129280-34-8
Isoangustone A( —— )
Catalog No. M31517 CAS No. 129280-34-8
Isoangustone A has antitumor activity, it can induce G1 cycle arrest in DU145 human prostate and 4T1 murine mammary cancer cells, it inhibits cell proliferation by targeting PI3K, MKK4, and MKK7 in human melanoma.
Purity : >98% (HPLC)
COA
Datasheet
HNMR
HPLC
MSDS
Handing Instructions
| Size | Price / USD | Stock | Quantity |
| 5MG | 548 | In Stock |
|
| 10MG | 781 | In Stock |
|
| 25MG | 1169 | In Stock |
|
| 50MG | 1562 | In Stock |
|
| 100MG | Get Quote | In Stock |
|
| 200MG | Get Quote | In Stock |
|
| 500MG | Get Quote | In Stock |
|
| 1G | Get Quote | In Stock |
|
Biological Information
-
Product NameIsoangustone A
-
NoteResearch use only, not for human use.
-
Brief DescriptionIsoangustone A has antitumor activity, it can induce G1 cycle arrest in DU145 human prostate and 4T1 murine mammary cancer cells, it inhibits cell proliferation by targeting PI3K, MKK4, and MKK7 in human melanoma.
-
DescriptionIsoangustone A has antitumor activity, it can induce G1 cycle arrest in DU145 human prostate and 4T1 murine mammary cancer cells, it inhibits cell proliferation by targeting PI3K, MKK4, and MKK7 in human melanoma. Isoangustone A dampens mesangial sclerosis associated with inflammation in response to high glucose through hindering TGF-β and NF- oB signaling. Isoangustone A also shows strong ferric reducing activities and effectively scavenged DPPH, ABTS(+), and singlet oxygen radicals.
-
In VitroCell Proliferation Assay Cell Line:SK-MEL-28 Concentration:10 and 20 μM Incubation Time:48 and 72 h Result:Inhibited proliferation in a dose- and time-dependent manner.Cell Cycle Analysis Cell Line:SK-MEL-28 Concentration: 10 and 20 μM Incubation Time:48 h Result:Caused cell cycle arrest at G1 phase.Western Blot Analysis Cell Line:SK-MEL-28 Concentration:10 and 20 μM Incubation Time:48 h Result:Inhibited the expression of cyclin D1 and cyclin E. Suppressed phosphorylation of Rb in a dose-dependent manner. Inhibited the phosphorylation of Akt (Ser473, Thr308) and GSK3β (Ser9). Suppressed the phosphorylation of JNK1/2, but had no effect on ERK1/2 or p38.Cell Autophagy Assay Cell Line:SW480 cells Concentration:20 μM Incubation Time:0.5, 2 and 4 h Result:Deformed mitochondria, nondegradable cellular debris were all observable together with autophagic vacuoles in cells after 4 h.Apoptosis Analysis Cell Line:SW480 cells Concentration:15 μM Incubation Time:6 hResult:Induced elevation of apoptotic Annexin V+/PI- and Annexin V+/PI+ cell populations.
-
In VivoAnimal Model:Male Balb/c nu/nu mice, SK-MEL-28 xenograft modelDosage:2 or 10 mg/kg Administration:Intraperitoneal injection, daily for 35 days Result:Significantly suppressed tumor weight compared to the control group. Markedly inhibited the expression of proliferating cell nuclear antigen (PCNA). Decreased phosphorylation levels of Akt.
-
Synonyms——
-
PathwayOthers
-
TargetOther Targets
-
Recptor——
-
Research Area——
-
Indication——
Chemical Information
-
CAS Number129280-34-8
-
Formula Weight422.47
-
Molecular FormulaC25H26O6
-
Purity>98% (HPLC)
-
Solubility——
-
SMILES——
-
Chemical Name——
Shipping & Storage Information
-
Storage(-20℃)
-
ShippingWith Ice Pack
-
Stability≥ 2 years
Reference
molnova catalog
related products
-
4-(3-chlorophenyl)-2...
4-(3-chlorophenyl)-2,3-dihydro-1,3-thiazol-2-one is a chemical compound.
-
RSS0680
RSS0680 is a protein kinase degrader that degrades a variety of kinases and can be used to study diseases caused by kinase abnormalities.
-
Exendin-4 peptide de...
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.
Cart
sales@molnova.com