Isoangustone A

CAS No. 129280-34-8

Isoangustone A( —— )

Catalog No. M31517 CAS No. 129280-34-8

Isoangustone A has antitumor activity, it can induce G1 cycle arrest in DU145 human prostate and 4T1 murine mammary cancer cells, it inhibits cell proliferation by targeting PI3K, MKK4, and MKK7 in human melanoma.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 548 In Stock
10MG 781 In Stock
25MG 1169 In Stock
50MG 1562 In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Isoangustone A
  • Note
    Research use only, not for human use.
  • Brief Description
    Isoangustone A has antitumor activity, it can induce G1 cycle arrest in DU145 human prostate and 4T1 murine mammary cancer cells, it inhibits cell proliferation by targeting PI3K, MKK4, and MKK7 in human melanoma.
  • Description
    Isoangustone A has antitumor activity, it can induce G1 cycle arrest in DU145 human prostate and 4T1 murine mammary cancer cells, it inhibits cell proliferation by targeting PI3K, MKK4, and MKK7 in human melanoma. Isoangustone A dampens mesangial sclerosis associated with inflammation in response to high glucose through hindering TGF-β and NF- oB signaling. Isoangustone A also shows strong ferric reducing activities and effectively scavenged DPPH, ABTS(+), and singlet oxygen radicals.
  • In Vitro
    Cell Proliferation Assay Cell Line:SK-MEL-28 Concentration:10 and 20 μM Incubation Time:48 and 72 h Result:Inhibited proliferation in a dose- and time-dependent manner.Cell Cycle Analysis Cell Line:SK-MEL-28 Concentration: 10 and 20 μM Incubation Time:48 h Result:Caused cell cycle arrest at G1 phase.Western Blot Analysis Cell Line:SK-MEL-28 Concentration:10 and 20 μM Incubation Time:48 h Result:Inhibited the expression of cyclin D1 and cyclin E. Suppressed phosphorylation of Rb in a dose-dependent manner. Inhibited the phosphorylation of Akt (Ser473, Thr308) and GSK3β (Ser9). Suppressed the phosphorylation of JNK1/2, but had no effect on ERK1/2 or p38.Cell Autophagy Assay Cell Line:SW480 cells Concentration:20 μM Incubation Time:0.5, 2 and 4 h Result:Deformed mitochondria, nondegradable cellular debris were all observable together with autophagic vacuoles in cells after 4 h.Apoptosis Analysis Cell Line:SW480 cells Concentration:15 μM Incubation Time:6 hResult:Induced elevation of apoptotic Annexin V+/PI- and Annexin V+/PI+ cell populations.
  • In Vivo
    Animal Model:Male Balb/c nu/nu mice, SK-MEL-28 xenograft modelDosage:2 or 10 mg/kg Administration:Intraperitoneal injection, daily for 35 days Result:Significantly suppressed tumor weight compared to the control group. Markedly inhibited the expression of proliferating cell nuclear antigen (PCNA). Decreased phosphorylation levels of Akt.
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    129280-34-8
  • Formula Weight
    422.47
  • Molecular Formula
    C25H26O6
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • 4-(3-chlorophenyl)-2...

    4-(3-chlorophenyl)-2,3-dihydro-1,3-thiazol-2-one is a chemical compound.

  • RSS0680

    RSS0680 is a protein kinase degrader that degrades a variety of kinases and can be used to study diseases caused by kinase abnormalities.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.