Cart
sales@molnova.com
Fmoc-NH-PEG12-CH2CH2COOH
CAS No. 1952360-91-6
Fmoc-NH-PEG12-CH2CH2COOH( —— )
Catalog No. M26959 CAS No. 1952360-91-6
Fmoc-NH-PEG12-CH2CH2COOH is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.
Purity : >98% (HPLC)
COA
Datasheet
HNMR
HPLC
MSDS
Handing Instructions
| Size | Price / USD | Stock | Quantity |
| 25MG | 28 | In Stock |
|
| 100MG | Get Quote | In Stock |
|
| 200MG | Get Quote | In Stock |
|
| 500MG | Get Quote | In Stock |
|
| 1G | Get Quote | In Stock |
|
Biological Information
-
Product NameFmoc-NH-PEG12-CH2CH2COOH
-
NoteResearch use only, not for human use.
-
Brief DescriptionFmoc-NH-PEG12-CH2CH2COOH is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.
-
DescriptionFmoc-NH-PEG12-CH2CH2COOH is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.(In Vitro):PROTACs contain two different ligands connected by a linker; one is a ligand for an E3 ubiquitin ligase and the other is for the target protein. PROTACs exploit the intracellular ubiquitin-proteasome system to selectively degrade target proteins.
-
In VitroPROTACs contain two different ligands connected by a linker; one is a ligand for an E3 ubiquitin ligase and the other is for the target protein. PROTACs exploit the intracellular ubiquitin-proteasome system to selectively degrade target proteins.
-
In Vivo——
-
Synonyms——
-
PathwayOthers
-
TargetOther Targets
-
RecptorHuman Endogenous Metabolite
-
Research Area——
-
Indication——
Chemical Information
-
CAS Number1952360-91-6
-
Formula Weight839.96
-
Molecular FormulaC42H65NO16
-
Purity>98% (HPLC)
-
Solubility——
-
SMILESO=C(OCC1C2=C(C3=C1C=CC=C3)C=CC=C2)NCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCC(O)=O
-
Chemical Name——
Shipping & Storage Information
-
Storage(-20℃)
-
ShippingWith Ice Pack
-
Stability≥ 2 years
Reference
1.Collot M, et al. Biotin sulfone as a new tool for synthetic oligosaccharide immobilization: application to multiple analysis profiling and surface plasmonic analysis of anti-Candida albicans antibody reactivity against alpha and beta (1-->2) oligomannosides. J Med Chem. 2008 Oct 9;51(19):6201-10.
molnova catalog
related products
-
Apraglutide TFA (129...
Apraglutide TFA (FE 203799 TFA), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum.
-
Exendin-4 peptide de...
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.
-
RXFP3/4 agonist 2
RXFP3/4 agonist 2 is a potent, non-peptidic bis-RXFP3/4 agonist that facilitates the interaction between RXFP3 and β-arrestin-2 and is useful for studying diseases caused by metabolic abnormalities.
