Fmoc-NH-PEG12-CH2CH2COOH

CAS No. 1952360-91-6

Fmoc-NH-PEG12-CH2CH2COOH( —— )

Catalog No. M26959 CAS No. 1952360-91-6

Fmoc-NH-PEG12-CH2CH2COOH is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
25MG 28 In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Fmoc-NH-PEG12-CH2CH2COOH
  • Note
    Research use only, not for human use.
  • Brief Description
    Fmoc-NH-PEG12-CH2CH2COOH is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.
  • Description
    Fmoc-NH-PEG12-CH2CH2COOH is a PEG-based PROTAC linker that can be used in the synthesis of PROTACs.(In Vitro):PROTACs contain two different ligands connected by a linker; one is a ligand for an E3 ubiquitin ligase and the other is for the target protein. PROTACs exploit the intracellular ubiquitin-proteasome system to selectively degrade target proteins.
  • In Vitro
    PROTACs contain two different ligands connected by a linker; one is a ligand for an E3 ubiquitin ligase and the other is for the target protein. PROTACs exploit the intracellular ubiquitin-proteasome system to selectively degrade target proteins.
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Human Endogenous Metabolite
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    1952360-91-6
  • Formula Weight
    839.96
  • Molecular Formula
    C42H65NO16
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    O=C(OCC1C2=C(C3=C1C=CC=C3)C=CC=C2)NCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCC(O)=O
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Collot M, et al. Biotin sulfone as a new tool for synthetic oligosaccharide immobilization: application to multiple analysis profiling and surface plasmonic analysis of anti-Candida albicans antibody reactivity against alpha and beta (1-->2) oligomannosides. J Med Chem. 2008 Oct 9;51(19):6201-10.
molnova catalog
related products
  • Apraglutide TFA (129...

    Apraglutide TFA (FE 203799 TFA), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • RXFP3/4 agonist 2

    RXFP3/4 agonist 2 is a potent, non-peptidic bis-RXFP3/4 agonist that facilitates the interaction between RXFP3 and β-arrestin-2 and is useful for studying diseases caused by metabolic abnormalities.