Cart
sales@molnova.com
Home - Products - Others - Other Targets - Fluorogestone acetate

Fluorogestone acetate

CAS No. 2529-45-5

Fluorogestone acetate( Flurogestone Acetate Flugestone Acetate Fluorogesterone Acetate SC9880 )

Catalog No. M24144 CAS No. 2529-45-5

Fluorogestone acetate showed a high potency with short duration of activity and performed physiologically similar to progesterone. FGA was approximately 20 - 25 times more potent than progesterone.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 73 In Stock
2MG 37 In Stock
5MG 62 In Stock
10MG 98 In Stock
25MG 188 In Stock
50MG 271 In Stock
100MG 386 In Stock
200MG 510 In Stock
500MG Get Quote In Stock
1G Get Quote In Stock
Get Quotation Bulk Inquiry Add to Cart

Biological Information

  • Product Name
    Fluorogestone acetate
  • Note
    Research use only, not for human use.
  • Brief Description
    Fluorogestone acetate showed a high potency with short duration of activity and performed physiologically similar to progesterone. FGA was approximately 20 - 25 times more potent than progesterone.
  • Description
    Fluorogestone acetate showed a high potency with short duration of activity and performed physiologically similar to progesterone. FGA was approximately 20 - 25 times more potent than progesterone.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    Flurogestone Acetate Flugestone Acetate Fluorogesterone Acetate SC9880
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    2529-45-5
  • Formula Weight
    406.49
  • Molecular Formula
    C23H31FO5
  • Purity
    >98% (HPLC)
  • Solubility
    In Vitro:?DMSO : 7.14 mg/mL (17.57 mM)
  • SMILES
    CC(O[C@]1(C(C)=O)CC[C@@]2([H])[C@]3([H])CCC4=CC(CC[C@]4(C)C3(F)[C@@H](O)C[C@]12C)=O)=O
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Swelum A A , Alowaimer A N , Abouheif M A . Use of fluorogestone acetate sponges or controlled internal drug release for estrus synchronization in ewes: Effects of hormonal profiles and reproductive performance[J]. Theriogenology, 2015, 84(4):498-503.
Calculator

Molecular Weight Calculator

Dilution Calculator

Molarity Calculator

molnova catalog
related products

  • Calcitonin (8-32), s...

    Calcitonin (8-32), salmon is a highly selective amylin receptor antagonist.Calcitonin is a hormone known to participate in calcium and phosphorus metabolism. In mammals, the major source of calcitonin is from the parafollicular or C cells in the thyroid gland. Calcitonin is a 32 amino acid peptide cleaved from a larger prohormone.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • (β-Asp3)-VIP (human,...

    (β-Asp3)-VIP (human, bovine, porcine, rat)

Sign In Join Free