N-BENZYLFORMAMIDE

CAS No. 588-46-5

N-BENZYLFORMAMIDE( —— )

Catalog No. M22662 CAS No. 588-46-5

N-BENZYLFORMAMIDE is a natural product from Lepidium meyenii Walp.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 28 In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G 27 In Stock

Biological Information

  • Product Name
    N-BENZYLFORMAMIDE
  • Note
    Research use only, not for human use.
  • Brief Description
    N-BENZYLFORMAMIDE is a natural product from Lepidium meyenii Walp.
  • Description
    N-BENZYLFORMAMIDE is a natural product from Lepidium meyenii Walp.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    588-46-5
  • Formula Weight
    149.19
  • Molecular Formula
    C9H11NO
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    CC(=O)NCc1ccccc1
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Vargas R , Garza J , Dixon D , et al. Conformational analysis of N-benzylformamide[J]. Journal of Molecular Structure Theochem, 2001, 541(1):243-251.
molnova catalog
related products
  • Lupanine

    Lupanine has a weak sedative effect on the central nervous system, interaction with specific drugs used for treatment of the CNS and for analgesic activity. Lupanine improves glucose homeostasis by influencing KATP-channels of pancreatic beta cells.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Iron sucrose

    Iron sucrose is treatment of iron deficiency anemia.