Triacontanoic Acid

CAS No. 506-50-3

Triacontanoic Acid( Melissic acid A )

Catalog No. M21285 CAS No. 506-50-3

Triacontanoic Acid belongs to the class of organic compounds known as very long-chain fatty acids.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 29 In Stock
10MG 38 In Stock
25MG 58 In Stock
50MG 80 In Stock
100MG Get Quote In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Triacontanoic Acid
  • Note
    Research use only, not for human use.
  • Brief Description
    Triacontanoic Acid belongs to the class of organic compounds known as very long-chain fatty acids.
  • Description
    Triacontanoic Acid belongs to the class of organic compounds known as very long-chain fatty acids.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    Melissic acid A
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    506-50-3
  • Formula Weight
    452.8
  • Molecular Formula
    C30H60O2
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC(O)=O
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Molina V Arruzazabala M L Carbajal D et al. Antiplatelet and Antithrombotic Effect of D-003[J]. Pharmacological Research the Official Journal of the Italian Pharmacological Society 2000 42(2):137-143.
molnova catalog
related products
  • Acetylcholine iodide

    Acetylcholine iodide is a neurotransmitter found at neuromuscular junctions, autonomic ganglia, parasympathetic effector junctions, a subset of sympathetic effector junctions, and at many sites in the central nervous system.

  • cis-Aegineoside

    cis-Aegineoside

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.