Prohydrojasmon

CAS No. 158474-72-7

Prohydrojasmon( Prohydrojasmon racemate | Propyl dihydrojasmonate )

Catalog No. M20650 CAS No. 158474-72-7

Prohydrojasmon is a synthesized plant gowth regulator which has jasmonic acid activity.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
1 mL x 10 mM in DMSO 29 In Stock
100MG Get Quote In Stock
200MG 33 In Stock
500MG 55 In Stock
1G 82 In Stock

Biological Information

  • Product Name
    Prohydrojasmon
  • Note
    Research use only, not for human use.
  • Brief Description
    Prohydrojasmon is a synthesized plant gowth regulator which has jasmonic acid activity.
  • Description
    Prohydrojasmon is a synthesized plant gowth regulator which has jasmonic acid activity.
  • In Vitro
    Prohydrojasmon racemate (n-propyl dihydrojasmonate, PDJ) is a functional analogue of Jasmonic acid (JA) . Prohydrojasmon racemate (n-propyl dihydrojasmonate, PDJ) is a plant growth promoter.
  • In Vivo
    ——
  • Synonyms
    Prohydrojasmon racemate | Propyl dihydrojasmonate
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    158474-72-7
  • Formula Weight
    254.37
  • Molecular Formula
    C15H26O3
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO:54 mg/mL (212.29 mM)
  • SMILES
    CCCCCC1C(CC(=O)OCCC)CCC1=O
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Cohen S Barer F Itzhak I et al. Effect of prohydrojasmon on total phenolic content anthocyanin accumulation and antioxidant activity in komatsuna and lettuce[J].J Immunol Res. 2018 May 15;2018:2310970.
molnova catalog
related products
  • Rimantadine

    Rimantadine (Flumadine) is an anti-influenza virus drug for T. brucei with IC50 of 7 μM.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

  • Lushanrubescensin H

    Lushanrubescensin H is a natural product from Isodon rubescens.