HA15

CAS No. 1609402-14-3

HA15( HA15 | HA-15 | HA 15 )

Catalog No. M17340 CAS No. 1609402-14-3

HA15 targets specifically BiP/GRP78/HSPA5. HA15 exhibits anti-cancerous activity on all melanoma cells tested, including cells isolated from patients and cells that developed resistance to BRAF inhibitors.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
2MG 42 In Stock
5MG 68 In Stock
10MG 87 In Stock
25MG 177 In Stock
50MG 312 In Stock
100MG 537 In Stock
200MG Get Quote In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    HA15
  • Note
    Research use only, not for human use.
  • Brief Description
    HA15 targets specifically BiP/GRP78/HSPA5. HA15 exhibits anti-cancerous activity on all melanoma cells tested, including cells isolated from patients and cells that developed resistance to BRAF inhibitors.
  • Description
    HA15 targets specifically BiP/GRP78/HSPA5. HA15 exhibits anti-cancerous activity on all melanoma cells tested, including cells isolated from patients and cells that developed resistance to BRAF inhibitors.
  • In Vitro
    HA15 (10 μM; 1-24 hours) induces an early endoplasmic reticulum stress (ER Stress).HA15 (0-10μM; 24 hours) decreases melanoma cell viability in a dose-dependent manner compared with control conditions (DMSO), with an IC50 of 1-2.5 μM in? A375 cells.HA15 (1-10 μM; 24 hours) induces apoptosis in A375 cells.HA15 (1-24 μM; 24 hours) induces autophagy.HA15 (10 μM; 48 hours) has high efficiency in inducing cell death and ER stress in BRAF-inhibitor-resistant melanoma cells. And HA15 inhibits tumor growth through autophagic and apoptotic mechanisms initiated by ER stress.No deleterious effects on the viability of normal human melanocytes or human fibroblasts were observed with low or high doses of HA15. Cell Viability Assay Cell Line:A375 cells Concentration:1 μM,2.5 μM,5 μM,7.5 μM,10 μM Incubation Time:24 hours Result:Decreased melanoma cell viability in a dose-dependent manner compared with control conditions (DMSO) in A375 cells.Apoptosis Analysis Cell Line:A375 cells Concentration:1 μM, 5 μM, 10 μM Incubation Time:24 hours Result:Induces apoptosis.Cell Autophagy Assay Cell Line:A375 cells Concentration:1 μM, 4 μM, 10 μM, 24 μMIncubation Time:24 hours Result:Increased LC3B-II expression after 1 hour and persisted after 24 hours, enhanced the expression level of Beclin 1, clearly be indicated that induces autophagy.Western Blot Analysis Cell Line:A375 cells Concentration:10 μM Incubation Time:1 hour, 4 hours, 10 hours, 24 hours Result:Exhibited a rapid induction within 1 hour of the ER stress markers (phosphorylation of PERK and elF2α and a weak increase in ATF4 and CHOP expression)
  • In Vivo
    HA15 (0.7 mg/mouse/day; i.h.; over 2 weeks) inhibits melanoma tumor development in mice, induces no apparent toxicity and no change in their behavior, body mass, or liver mass, suggesting an absence of hepatomegaly. HA15 (0.7 mg/mouse; i.p.; 5 days/week) suppresses MPM tumor growth in vivo. Animal Model:6-weeks female BALB/c nu/nu (nude) mice with A375 melanoma cells xenograft Dosage:0.7 mg/mouse/day dministration: Subcutaneous injection; over a period of 2 weeks Result:Attenuated the development of tumors.Animal Model:Mouse, NSG (NOD-scid IL2Rγnull) Dosage:0.7 mg/mouse Administration:Intraperitoneal injection, 5 days/week, for 5 weeks Result:Suppressed MPM tumor growth.
  • Synonyms
    HA15 | HA-15 | HA 15
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    GRP78| HSPA5| BiP
  • Research Area
    Cancer
  • Indication
    ——

Chemical Information

  • CAS Number
    1609402-14-3
  • Formula Weight
    466.58
  • Molecular Formula
    C23H22N4O3S2
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO : ≥ 50 mg/mL. 107.16 mM; H2O : < 0.1 mg/mL
  • SMILES
    CC(=O)Nc1nc(c2cccc(NS(=O)(=O)c3c4cccc(N(C)C)c4ccc3)c2)cs1
  • Chemical Name
    N-(4-(3-((5-(dimethylamino)naphthalene)-1-sulfonamido)phenyl)thiazol-2-yl)acetamide

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Cerezo M et al. Cancer Cell. 2016 Jun 13;29(6):805-19.
molnova catalog
related products
  • Keto-pantoyllactone

    Keto-pantoyllactone is assayed by the ketopantoyl lactone-dependent oxidation of nicotinamide adenine dinucleotide phosphate.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • 6-Thio-dG

    6-thio-dG is a nucleoside analog and telomerase substrate.