Domperidone EP Impurity A

CAS No. 53786-28-0

Domperidone EP Impurity A( —— )

Catalog No. M14917 CAS No. 53786-28-0

Used as pharmaceutical intermediates.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
100MG Get Quote In Stock
200MG 27 In Stock
500MG Get Quote In Stock
1G Get Quote In Stock

Biological Information

  • Product Name
    Domperidone EP Impurity A
  • Note
    Research use only, not for human use.
  • Brief Description
    Used as pharmaceutical intermediates.
  • Description
    Used as pharmaceutical intermediates.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    53786-28-0
  • Formula Weight
    251.71
  • Molecular Formula
    C12H14ClN3O
  • Purity
    >98% (HPLC)
  • Solubility
    Limited solubility
  • SMILES
    ClC1=CC2=C(C=C1)N(C1CCNCC1)C(=O)N2
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Minoxidil sulphate

    Minoxidil sulphate is the active metabolite required to exert the vasodilatory and hair growing effects of minoxidil.

  • Caryatin

    Caryatin is a natural product found in Rhododendron simiarum, and Aeonium decorum. Caryatin shows anti-tumor activity.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.