Deschloroclozapine

CAS No. 1977-07-7

Deschloroclozapine( —— )

Catalog No. M26171 CAS No. 1977-07-7

Deschloroclozapine, a metabolite of Clozapine, is a highly potent muscarinic DREADDs agonist.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 45 Get Quote
10MG 72 Get Quote
25MG 140 Get Quote
50MG 260 Get Quote
100MG 404 Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    Deschloroclozapine
  • Note
    Research use only, not for human use.
  • Brief Description
    Deschloroclozapine, a metabolite of Clozapine, is a highly potent muscarinic DREADDs agonist.
  • Description
    Deschloroclozapine, a metabolite of Clozapine, is a highly potent muscarinic DREADDs agonist. Deschloroclozapine binds to DREADD receptor subtypes hM3Dq and hM4Di with Ki of 6.3 and 4.2 nM, respectively.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    GABAA
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    1977-07-7
  • Formula Weight
    292.386
  • Molecular Formula
    C18H20N4
  • Purity
    >98% (HPLC)
  • Solubility
    In Vitro:?DMSO : 100 mg/mL (342.02 mM)
  • SMILES
    CN1CCN(CC1)C1=Nc2ccccc2Nc2ccccc12
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Ali Y Benkherouf, et al. Hops Compounds Modulatory Effects and 6-prenylnaringenin Dual Mode of Action on GABA AReceptors. Eur J Pharmacol. 2020 Apr 15;873:172962.
molnova catalog
related products
  • Methylcobalamin

    Methylcobalamin a cobalamin, is a form of vitamin B12.

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Trachelogenin 4-O-be...

    Trachelogenin 4'-O-beta-gentiobioside is a natural product for research related to life sciences.