Cart
sales@molnova.com
Home - Products - Others - Other Targets - Anetumab

Anetumab

CAS No. 1954758-84-9

Anetumab( —— )

Catalog No. M36743 CAS No. 1954758-84-9

Anetumab is a novel fully human anti-mesothelin IgG1 antibody that is a naked antibody to Anetumab ravtansine.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
2MG 441 Get Quote
5MG 717 Get Quote
10MG 1121 Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote
Get Quotation Bulk Inquiry Add to Cart

Biological Information

  • Product Name
    Anetumab
  • Note
    Research use only, not for human use.
  • Brief Description
    Anetumab is a novel fully human anti-mesothelin IgG1 antibody that is a naked antibody to Anetumab ravtansine.
  • Description
    Anetumab (Anti-MSLN Antibody) is an anti-mesothelin (MSLN) antibody. MSLN is a tumor-associated antigen. Anetumab can be used to synthesis Anetumab ravtansine, a MSLN-targeting antibody-drug conjugate (ADC). Anetumab can be used for the research of malignant tumor.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    1954758-84-9
  • Formula Weight
  • Molecular Formula
    ——
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1. Golfier S, et al. Anetumab ravtansine: a novel mesothelin-targeting antibody-drug conjugate cures tumors with heterogeneous target expression favored by bystander effect. Mol Cancer Ther. 2014 Jun;13(6):1537-48.?
Calculator

Molecular Weight Calculator

Dilution Calculator

Molarity Calculator

molnova catalog
related products

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • FEN1-IN-2

    FEN1-IN-2 is a selective and potent inhibitor of flap endonuclease 1 (FEN1), inhibits FEN1 and XPG, has potential anticancer activity, and can be used to study DNA damage repair.

  • ARN25068

    ARN25068 is a potent inhibitor of GSK-3β, FYN, and DYRK1A protein kinases, exerting its activity in the sub-micromolar range. This compound effectively addresses tau hyperphosphorylation .

Sign In Join Free